{"product_id":"proteintech-68328-1-ig","title":"Proteintech, 68328-1-Ig, SH3BP1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SH3BP1 (68328-1-Ig) by Proteintech is a Monoclonal antibody targeting SH3BP1 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n68328-1-Ig targets SH3BP1 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HSC-T6 cells, LNCaP cells,  HepG2 cells,  Jurkat cells,  NIH\/3T3 cells,  4T1 cells\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:1000-1:4000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSH3BP1 is also named as Chimeric SH3BP1-PDXP protein and BARGIN, and belongs to the to the RhoGAP family. SH3BP1 can be as a partner of the exocyst complex and establish a physical and functional link between two motility-driving pathways, the Ral\/exocyst and Rac signaling pathways. (PMID:21658605). SH3BP1 localizes together with the exocyst to the leading edge of motile cells and that SH3BP1 regulates cell migration via its GAP activity upon Rac1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag15165 Product name: Recombinant human SH3BP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC008282 Sequence: MAESFKELDPDSSMGKALEMSCAIQNQLARILAEFEMTLERDVLQPLSRLSEEELPAILKHKKSLQKLVSDWNTLKSRLSQATKNSGSSQGLGGSPGSHSHTTMANKVETLKEEEEELKRKVEQCRDEYLADLYHFVTKEDSYANYFIRLLEIQADYHRRSLSSLDTALAELRENHGQADHSPSMTATHFPRVYGVSLATHLQELGREIALPIEACVMMLLSEGMKEEGLFRLAAGASVLKRLKQTMASDPHSLEEFCSDPHAVAGALKSYLRELPEPLMTFDLYDDWMRAASLKEPGARLQALQEVCSRLPPENLSNLRYLMKFLARLAEEQEVNKMTPSNIAIVLGPN Predict reactive species\nFull Name: SH3-domain binding protein 1\nCalculated Molecular Weight: 701 aa, 76 kDa\nObserved Molecular Weight: 76-80 kDa\nGenBank Accession Number: BC008282\nGene Symbol: SH3BP1\nGene ID (NCBI): 23616\nRRID: AB_2935400\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y3L3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888323350697,"sku":"68328-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68328-1-ig","provider":"Iright","version":"1.0","type":"link"}