{"product_id":"proteintech-68331-1-ig","title":"Proteintech, 68331-1-Ig, ZNHIT3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNHIT3 (68331-1-Ig) by Proteintech is a Monoclonal antibody targeting ZNHIT3 in WB, IF\/ICC, ELISA applications with reactivity to Human samples\n68331-1-Ig targets ZNHIT3 in WB, IF\/ICC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: hTERT-RPE1 cells, Jurkat cells,  T-47D cells,  MOLT-4 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNHIT3, also named TRIP3, belongs to the zinc finger HIT (Zf-HIT) domain-containing proteins family. ZNHIT3 encodes a nuclear zinc finger protein previously implicated in transcriptional regulation and small nucleolar ribonucleoprotein particle assembly and thus possibly to pre-ribosomal RNA processing (PMID: 28335020). ZNHIT3 contains at least two domains: a ZN-HIT domain that consists of a double zinc-finger, probably involved in protein−protein interaction, and a PAC-HIT domain that folds into a clamp able to trap an α-helix, here again of about 20 residues, located in the sequence of NUFIP1 (PMID: 35315277). ZNHIT3 has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29872 Product name: Recombinant human ZNHIT3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-155 aa of BC017931 Sequence: MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFADCCLGIVEPSQNEES Predict reactive species\nFull Name: zinc finger, HIT type 3\nCalculated Molecular Weight: 155 aa, 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC017931\nGene Symbol: ZNHIT3\nGene ID (NCBI): 9326\nRRID: AB_2935403\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15649\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888337801385,"sku":"68331-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68331-1-ig","provider":"Iright","version":"1.0","type":"link"}