{"product_id":"proteintech-68335-1-ig","title":"Proteintech, 68335-1-Ig, TXNDC9 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TXNDC9 (68335-1-Ig) by Proteintech is a Monoclonal antibody targeting TXNDC9 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples\n68335-1-Ig targets TXNDC9 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, HEK-293 cells,  LNCaP cells,  HeLa cells,  HepG2 cells,  Jurkat cells,  K-562 cells\nPositive FC (Intra) detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTXNDC9, also known as APACD, has a negative effect on protein folding by significantly reducing the activity of chaperone protein TCP1 complex ATPase activity. Including actin or tubulin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag33259 Product name: Recombinant human TXNDC9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-226 aa of BC005968 Sequence: MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD Predict reactive species\nFull Name: thioredoxin domain containing 9\nCalculated Molecular Weight: 226 aa, 27 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC005968\nGene Symbol: TXNDC9\nGene ID (NCBI): 10190\nRRID: AB_3085059\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O14530\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888333934761,"sku":"68335-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68335-1-ig","provider":"Iright","version":"1.0","type":"link"}