{"product_id":"proteintech-68348-1-ig","title":"Proteintech, 68348-1-Ig, IRSp53 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IRSp53 (68348-1-Ig) by Proteintech is a Monoclonal antibody targeting IRSp53 in WB, ELISA applications with reactivity to Human, Mouse, Rat, Rabbit samples\n68348-1-Ig targets IRSp53 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat, Rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rabbit brain tissue, LNCaP cells,  rabbit cerebellum tissue,  rat brain tissue,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIRSp53 (also known as BAIAP2) is a multi-domain adaptor protein that originally identified as a 58\/53-kDa substrate of insulin-receptor kinase in the hamster (PMID: 10332026). As a BAI1-binding protein, IRSp53 plays an important role in linking between membrane and cytoskeleton in the process of neuronal growth (PMID: 10343108). IRSp53 is necessary for Cdc42-mediated reorganization of the actin cytoskeleton and for Rac1-mediated membrane ruffling. Alternatively spliced isoforms of IRSp53 exist. IRSp53 has been implicated in several psychiatric disorders, including autism spectrum disorders (ASDs), schizophrenia, and attention deficit\/hyperactivity disorder (ADHD) (PMID: 26275848).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat, Rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25161 Product name: Recombinant human BAIAP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-300 aa of BC014020 Sequence: MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMN Predict reactive species\nFull Name: BAI1-associated protein 2\nCalculated Molecular Weight: 61 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC014020\nGene Symbol: IRSp53\nGene ID (NCBI): 10458\nRRID: AB_3085071\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9UQB8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888288026793,"sku":"68348-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68348-1-ig","provider":"Iright","version":"1.0","type":"link"}