{"product_id":"proteintech-68354-1-ig","title":"Proteintech, 68354-1-Ig, CRYBA2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CRYBA2 (68354-1-Ig) by Proteintech is a Monoclonal antibody targeting CRYBA2 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n68354-1-Ig targets CRYBA2 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat eye tissue, mouse eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCRYBA2, also named as Beta A2 crystallin, is a member of crystallin superfamily. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also defined as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Crystallins are the dominant structural components of the vertebrate eye lens. The MW of this protein is 22 kDa, and this antibody specially recognises the 22 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8244 Product name: Recombinant human CRYBA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-197 aa of BC006285 Sequence: MSSAPAPGPAPASLTLWDEEDFQGRRCRLLSDCANVCERGGLPRVRSVKVENGVWVAFEYPDFQGQQFILEKGDYPRWSAWSGSSSHNSNQLLSFRPVLCANHNDSRVTLFEGDNFQGCKFDLVDDYPSLPSMGWASKDVGSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH Predict reactive species\nFull Name: crystallin, beta A2\nCalculated Molecular Weight: 197 aa, 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC006285\nGene Symbol: CRYBA2\nGene ID (NCBI): 1412\nRRID: AB_3085076\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P53672\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888111997097,"sku":"68354-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68354-1-ig","provider":"Iright","version":"1.0","type":"link"}