{"product_id":"proteintech-68362-1-ig","title":"Proteintech, 68362-1-Ig, NDUFB7 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFB7 (68362-1-Ig) by Proteintech is a Monoclonal antibody targeting NDUFB7 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n68362-1-Ig targets NDUFB7 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, MCF-7 cells,  HeLa cells,  HEK-293 cells,  PC-3 cell,  pig heart tissue,  rabbit heart tissue,  rat heart tissue,  mouse heart tissue\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDUFB7(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7) is also named as CI-B18 and belongs to the complex I NDUFB7 subunit family. It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which couples the oxidation of NADH to the reduction of ubiquinone and the translocation of protons across the inner membrane. NDUFB7 protein lacks a mitochondrial targeting signal and transmembrane domains. However, it has a Cx(9)C motif that includes an intermembrane space targeting signal.(PMID:21310150).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6720 Product name: Recombinant human NDUFB7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-137 aa of BC002595 Sequence: MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC002595\nGene Symbol: NDUFB7\nGene ID (NCBI): 4713\nRRID: AB_3085084\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P17568\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888302313641,"sku":"68362-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68362-1-ig","provider":"Iright","version":"1.0","type":"link"}