{"product_id":"proteintech-68368-1-ig","title":"Proteintech, 68368-1-Ig, RAP2A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAP2A (68368-1-Ig) by Proteintech is a Monoclonal antibody targeting RAP2A in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n68368-1-Ig targets RAP2A in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, rabbit brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRas-related protein Rap-2a (RAP2A) is also named as RbBP-30, and belongs to the small GTPase superfamily and Ras family. RAP2A is small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. In its active form, RAP2A can interact with and regulates several effectors including MAP4K4, MINK1 and TNIK. a Nedd4-1\/Rap2A\/TNIK signaling pathway regulates neurite growth and arborization in mammalian neurons (PMID:20159449). Early research indicated that RAP2A is mainly located in the Golgi apparatus of mammalian cells. RAP2A functions in several cascade signals to regulate biological behaviors such as cytoskeletal rearrangement, cell growth and apoptosis, and cell adhesion and migration (PMID:34018090, PMID:16246175, PMID: 16540189).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag4979 Product name: Recombinant human RAP2A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-183 aa of BC041333 Sequence: MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ Predict reactive species\nFull Name: RAP2A, member of RAS oncogene family\nCalculated Molecular Weight: 183 aa, 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC041333\nGene Symbol: RAP2A\nGene ID (NCBI): 5911\nRRID: AB_3085088\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P10114\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888317485225,"sku":"68368-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68368-1-ig","provider":"Iright","version":"1.0","type":"link"}