{"product_id":"proteintech-68386-1-ig","title":"Proteintech, 68386-1-Ig, SNX27 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNX27 (68386-1-Ig) by Proteintech is a Monoclonal antibody targeting SNX27 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n68386-1-Ig targets SNX27 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, LNCaP cells,  HeLa cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  4T1 cells\nPositive IF\/ICC detected in: HeLa cells, HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSorting nexin 27 (SNX27), a PDZ domain-containing protein, belongs to the sorting nexin family of proteins. SNX27 promotes the recycling of internalized transmembrane proteins from endosomes to the plasma membrane by linking PDZ-dependent cargo recognition to retromer-mediated transport (PMID: 21602791; 23563491). It has been shown that SNX27 deficiency contributes to synaptic and cognitive deficits by modulating glutamate receptor recycling in Down's syndrome (PMID: 23524343). SNX27 has also been proposed to have a role in regulating β-amyloid (Aβ) generation by modulating γ-secretase activity, which is a molecular mechanism for Aβ-dependent pathogenesis in both Down's syndrome and Down's syndrome (PMID: 25437557).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9447 Product name: Recombinant human SNX27 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 310-528 aa of BC012184 Sequence: MDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNYTSAVPGTCLTIRKWLFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQRKMVMYLNMLRTCEGYNEIIFPHCACDSRRKGHVITAISITHFKLHACTEEGQLENQVIAFEWDEMQRWDTDEEGMAFCFEYARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKEEY Predict reactive species\nFull Name: sorting nexin family member 27\nCalculated Molecular Weight: 61 kDa, 60 kDa, 52 kDa, 28 kDa\nObserved Molecular Weight: 61 kDa\nGenBank Accession Number: BC012184\nGene Symbol: SNX27\nGene ID (NCBI): 81609\nRRID: AB_3085104\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q96L92\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888076279977,"sku":"68386-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68386-1-ig","provider":"Iright","version":"1.0","type":"link"}