{"product_id":"proteintech-68389-1-ig","title":"Proteintech, 68389-1-Ig, RAB33A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB33A (68389-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB33A in WB, IF\/ICC, ELISA applications with reactivity to Human, rat, mouse, pig, rabbit samples\n68389-1-Ig targets RAB33A in WB, IF\/ICC, ELISA applications and shows reactivity with Human, rat, mouse, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, SH-SY5Y cells,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IF\/ICC detected in: Neuro-2a cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRas-related protein Rab-33A (RAB33A) is also named as RABS10, and belongs to the small GTPase superfamily and the Rab family. RAB33A is an X-linked gene that is expressed in brain, lymphocytes, and normal melanocytes, but is downregulated in melanoma cells. In the brain, RAB33A is present throughout the cortex, as well as in the hippocampal CA fields (PMID:16810302). RAB33A is expressed in cells, including neurons, lymphocytes, melanocytes and parotid acinar cells (PMID:16810302, PMID:25871792). In cultured rat hippocampal neurons, RAB33A is localized to the Golgi apparatus and post-Golgi vesicles transported along axons (PMID:22972995).In addition, RAB33A interacts with singar1\/RUFY3, which suppresses the formation of surplus axons in cultured hippocampal neurons (PMID:21737958, PMID:17439943).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat, mouse, pig, rabbit\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag33188 Product name: Recombinant human RAB33A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-237 aa of BC009996 Sequence: MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC Predict reactive species\nFull Name: RAB33A, member RAS oncogene family\nCalculated Molecular Weight: 27 kDa\nGenBank Accession Number: BC009996\nGene Symbol: RAB33A\nGene ID (NCBI): 9363\nRRID: AB_3085107\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q14088\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888072773801,"sku":"68389-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68389-1-ig","provider":"Iright","version":"1.0","type":"link"}