{"product_id":"proteintech-68400-1-ig","title":"Proteintech, 68400-1-Ig, METTL6 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe METTL6 (68400-1-Ig) by Proteintech is a Monoclonal antibody targeting METTL6 in WB, IHC, ELISA applications with reactivity to human samples\n68400-1-Ig targets METTL6 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  LNCaP cells,  HEK-293 cells,  Jurkat cells,  K-562 cells\nPositive IHC detected in: human breast cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMethyltransferase-like protein 6 (METTL6) belongs to the METL family. METTL6 is as a crucial regulator of tumor cell growth, and METTL6 is a bona fide transfer RNA (tRNA) methyltransferase, catalyzing the formation of 3-methylcytidine at C32 of specific serine tRNA isoacceptors (PMID:32923617). METTL6 is a member of the RNA methyltransferase family that has been identified in many cancers. The mRNA expression levels of METTL6 were significantly upregulated in HCC tumor tissues compared to that in adjacent non tumor tissues. CRISPR\/Cas9 mediated knockout of METTL6 in hepatocellular carcinoma cell lines remarkably inhibited colony formation, cell proliferation, cell migration, cell invasion and cell attachment ability (PMID:34913069).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9714 Product name: Recombinant human METTL6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-250 aa of BC022400 Sequence: MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVN Predict reactive species\nFull Name: methyltransferase like 6\nCalculated Molecular Weight: 255 aa, 30 kDa\nObserved Molecular Weight: 30-32 kDa\nGenBank Accession Number: BC022400\nGene Symbol: METTL6\nGene ID (NCBI): 131965\nRRID: AB_3085117\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8TCB7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888292647081,"sku":"68400-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68400-1-ig","provider":"Iright","version":"1.0","type":"link"}