{"product_id":"proteintech-68402-1-ig","title":"Proteintech, 68402-1-Ig, IGFBP3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IGFBP3 (68402-1-Ig) by Proteintech is a Monoclonal antibody targeting IGFBP3 in WB, IHC, ELISA applications with reactivity to human samples\n68402-1-Ig targets IGFBP3 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, human placenta tissue,  Caco-2 cells\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInsulin-like growth factor binding protein-3 (IGFBP-3) contains a 27 amino acid putative signal sequence followed by a mature protein of 264 amino acids with 18 cysteine residues clustered near the N- and C-terminus. Accordingly, expression of the cloned IGFBP-3 cDNA in mammalian tissue culture cells results in secretion of the protein into the culture medium.  IGFBP-3 shares high homology (33% amino acid identity) including conservation of all 18 cysteine residues with a smaller human IGF-binding protein (BP-28) identified in amniotic fluid. IGFBP-3 has one or more glycosylation sites with a protein core of ∼30 kDa. Western blots revealed that the 39-45 kDa IGFBP-3 fragment is a glycoprotein. (PMID: 23403918, PMID: 24926947, PMID: 19887447)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgM\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag20351 Product name: Recombinant human IGFBP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 134-291 aa of BC000013 Sequence: PGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK Predict reactive species\nFull Name: insulin-like growth factor binding protein 3\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 39-45 kDa\nGenBank Accession Number: BC000013\nGene Symbol: IGFBP3\nGene ID (NCBI): 3486\nRRID: AB_3085119\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Thiophilic affinity chromatograph\nUNIPROT ID: P17936\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888285798569,"sku":"68402-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68402-1-ig","provider":"Iright","version":"1.0","type":"link"}