{"product_id":"proteintech-68459-1-ig","title":"Proteintech, 68459-1-Ig, SQRDL Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SQRDL (68459-1-Ig) by Proteintech is a Monoclonal antibody targeting SQRDL in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, pig samples\n68459-1-Ig targets SQRDL in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HepG2 cells,  HT-29 cells,  hTERT-RPE1 cells,  THP-1 cells,  pig liver tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSQRDL(Sulfide:quinone oxidoreductase, mitochondrial) catalyzes the oxidation of hydrogen sulfide, with the help of a quinone.Although the SQRDL precursor protein displays a molecular weight of 50 kDa,a prominent band at about 46 kDa is detected by western blot. This discrepancy reflects the cleavage of an N-terminal targeting sequence of 4 kDa during the import of the protein into the mitochondria(PMID:22067608).SQRDL is one of the enzymes involved in H2S signaling in a discrete population of neurons, oligodendrocytes, and endothelial cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag10762 Product name: Recombinant human SQRDL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-450 aa of BC016836 Sequence: GRPTASVIPSGVEWIKARVTELNPDKNCIHTDDDEKISYRYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDKPGETQVISYEMLHVTPPMSPPDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKADLMPFLYWNMMLRGYWGGPAFLRKLFHLGMS Predict reactive species\nFull Name: sulfide quinone reductase-like (yeast)\nCalculated Molecular Weight: 450 aa, 50 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC016836\nGene Symbol: SQRDL\nGene ID (NCBI): 58472\nRRID: AB_3085171\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y6N5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888326856873,"sku":"68459-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68459-1-ig","provider":"Iright","version":"1.0","type":"link"}