{"product_id":"proteintech-68478-1-ig","title":"Proteintech, 68478-1-Ig, NUDT10 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NUDT10 (68478-1-Ig) by Proteintech is a Monoclonal antibody targeting NUDT10 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n68478-1-Ig targets NUDT10 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, rat brain tissue,  HEK-293 cells,  rat testis tissue,  mouse testis tissue,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNUDT10 (nucleoside diphosphate linked moiety X-type motif 10), also named as DIPP3A or APS2, belongs to the subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (PMID: 12105228, 12689335). Five human isoforms of DIPP have been found and named as DIPP type 1(NUDT3), type 2α\/β(NUDT4), type 3α(NUDT10) and type 3β(NUDT11), which have the similar molecular weight and high homology (PMID: 12105228).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag11878 Product name: Recombinant human NUDT10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-164 aa of BC050700 Sequence: MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPEHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP Predict reactive species\nFull Name: nudix (nucleoside diphosphate linked moiety X)-type motif 10\nCalculated Molecular Weight: 164 aa, 19 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC050700\nGene Symbol: NUDT10\nGene ID (NCBI): 170685\nRRID: AB_3085189\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8NFP7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888306999465,"sku":"68478-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68478-1-ig","provider":"Iright","version":"1.0","type":"link"}