{"product_id":"proteintech-68496-1-ig","title":"Proteintech, 68496-1-Ig, STT3B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe STT3B (68496-1-Ig) by Proteintech is a Monoclonal antibody targeting STT3B in WB, FC (Intra), ELISA applications with reactivity to human samples\n68496-1-Ig targets STT3B in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HepG2 cells,  Jurkat cells,  K-562 cells\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTT3B is a component of the N-oligosaccharyl transferase (OST) enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser\/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). SST3B seems to be involved in complex substrate specificity\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30866 Product name: Recombinant human STT3B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 173-225 aa of BC015880 Sequence: APDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIKNKLVFKKGKKIFKKTV Predict reactive species\nFull Name: STT3, subunit of the oligosaccharyltransferase complex, homolog B (S. cerevisiae)\nCalculated Molecular Weight: 97 kDa\nObserved Molecular Weight: 94 kDa\nGenBank Accession Number: BC015880\nGene Symbol: STT3B\nGene ID (NCBI): 201595\nRRID: AB_3085207\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8TCJ2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887970013353,"sku":"68496-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68496-1-ig","provider":"Iright","version":"1.0","type":"link"}