{"product_id":"proteintech-68506-1-ig","title":"Proteintech, 68506-1-Ig, ATP6V0D1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP6V0D1 (68506-1-Ig) by Proteintech is a Monoclonal antibody targeting ATP6V0D1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to Human, Mouse, Rat, Pig, Rabbit, Chicken, Zebrafish samples\n68506-1-Ig targets ATP6V0D1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit, Chicken, Zebrafish samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  K-562 cells,  pig brain tissue,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue,  chicken brain tissue,  zebrafish tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:1200-1:4800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP6V0D1(V-type proton ATPase subunit d 1) is also named as ATP6D, VPATPD and belongs to the V-ATPase V0D\/AC39 subunit family.It is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat, Pig, Rabbit, Chicken, Zebrafish\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag13012 Product name: Recombinant human ATP6V0D1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC008861 Sequence: MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF Predict reactive species\nFull Name: ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1\nCalculated Molecular Weight: 351 aa, 40 kDa\nObserved Molecular Weight: 37-41 kDa\nGenBank Accession Number: BC008861\nGene Symbol: ATP6V0D1\nGene ID (NCBI): 9114\nRRID: AB_3085216\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P61421\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888101183657,"sku":"68506-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68506-1-ig","provider":"Iright","version":"1.0","type":"link"}