{"product_id":"proteintech-68546-1-ig","title":"Proteintech, 68546-1-Ig, RPAIN Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RPAIN (68546-1-Ig) by Proteintech is a Monoclonal antibody targeting RPAIN in WB, ELISA applications with reactivity to human samples\n68546-1-Ig targets RPAIN in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Jurkat cells,  A2780 cells,  LNCap cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nReplication protein A (RPA) is a eukaryotic single-stranded DNA binding protein that is essential for DNA replication, repair, and recombination, and human RPA interacting protein α (hRIPα) is the nuclear transporter of RPA. RPAIN was originally identified as a nuclear transporter of RPA in Xenopus (PMID: 23010595). The human RIPα gene encodes several splice isoforms, of which hRIPα and hRIPβ are the major translation products in vivo.hRIPα transports RPA into the nucleus by shuttling between the cytoplasm and nucleus while hRIPβ is localized in promyelocytic leukemia (PML) nuclear bodies.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7844 Product name: Recombinant human RPAIN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-145 aa of BC004451 Sequence: MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWNALQSVENCPEDLAQLEELIDMAVLEEIQQELINQEQSIISEYEKSLQFDEKCLSIMLAEWEANPLICPVCTNLLS Predict reactive species\nFull Name: RPA interacting protein\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC004451\nGene Symbol: RPAIN\nGene ID (NCBI): 84268\nRRID: AB_3085251\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q86UA6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888319910057,"sku":"68546-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68546-1-ig","provider":"Iright","version":"1.0","type":"link"}