{"product_id":"proteintech-68547-1-ig","title":"Proteintech, 68547-1-Ig, SKIV2L Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SKIV2L (68547-1-Ig) by Proteintech is a Monoclonal antibody targeting SKIV2L in WB, IHC, ELISA applications with reactivity to human samples\n68547-1-Ig targets SKIV2L in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  Jurkat cells,  MOLT-4 cells,  NK-92 cells\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Ski complex is a multiprotein complex required for exosome-mediated RNA surveillance, including the regulation of normal mRNA and the decay of nonfunctional mRNA. Component of the SKI complex which is thought to be involved in exosome-mediated RNA decay and associates with transcriptionally active genes in a manner dependent on PAF1 complex (PAF1C) [PMID:22444670]. SKIV2L , one component of the Ski complex, acts as an RNA helicase with a role in exosome recruitment or activation. It is involved in the degradation of RNAs by the exosome and may have a role in autophagy [PMID:11719186].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag33679 Product name: Recombinant human SKIV2L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 861-1246 aa of BC015758 Sequence: QVSSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGPCDHTVVKLQPGDMAAITTKVLRVNGEKILEDFSKRQQPKFKKDPPLAAVTTAVQELLRLAQAHPAGPPTLDPVNDLQLKDMSVVEGGLRARKLEELIQGAQCVHSPRFPAQYLKLRERMQIQKEMERLRFLLSDQSLLLLPEYHQRVEVLRTLGYVDEVGTVKLAGRVACAMSSHELLLTELMFDNALSTLRPEEIAALLSGLVCQSPGDAGDQLPNTLKQGIERVRAVAKRIGEVQVACGLNQTVEEFVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLLRRDIVFAASLYTQ Predict reactive species\nFull Name: superkiller viralicidic activity 2-like (S. cerevisiae)\nCalculated Molecular Weight: 1246 aa, 138 kDa\nObserved Molecular Weight: 138-145 kDa\nGenBank Accession Number: BC015758\nGene Symbol: SKIV2L\nGene ID (NCBI): 6499\nRRID: AB_3085252\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15477\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888324137129,"sku":"68547-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68547-1-ig","provider":"Iright","version":"1.0","type":"link"}