{"product_id":"proteintech-68562-1-ig","title":"Proteintech, 68562-1-Ig, TRPS1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRPS1 (68562-1-Ig) by Proteintech is a Monoclonal antibody targeting TRPS1 in WB, ELISA applications with reactivity to Human samples\n68562-1-Ig targets TRPS1 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Saos-2 cells, HeLa cells,  T-47D cells,  MCF-7cells,  LNCaP cells,  HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRPS1 is a zinc finger transcriptional repressor involved in the regulation of chondrocyte and perichondrium development, containing a GATA-type zinc finger through which it binds to DNA. with nine zinc-finger domains and two C-terminal Ikaros-like zinc fingers. Its reperssible function was dependent on the integrity of the Trps1 GATA-type zinc-finger domain and also required the C-terminal 119 amino acids of the protein, which harbor the two Ikaros-like zinc-finger domains\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30199 Product name: Recombinant human TRPS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1158-1281 aa of NM_014112 Sequence: SDNDIPLDLAIKHSRPGPTANGASKEKTKAPPNVKNEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSICQHLCTDKYDFTTHIQRGLHRNNAQVEKNGKPKE Predict reactive species\nFull Name: trichorhinophalangeal syndrome I\nCalculated Molecular Weight: 142 kDa\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: NM_014112\nGene Symbol: TRPS1\nGene ID (NCBI): 7227\nRRID: AB_3085264\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9UHF7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888333246633,"sku":"68562-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68562-1-ig","provider":"Iright","version":"1.0","type":"link"}