{"product_id":"proteintech-68568-1-ig","title":"Proteintech, 68568-1-Ig, LEO1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe LEO1 (68568-1-Ig) by Proteintech is a Monoclonal antibody targeting LEO1 in WB, ELISA applications with reactivity to Human samples\n68568-1-Ig targets LEO1 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HT-29 cells,  A549 cells,  HEK-293 cells,  LNCaP cells,  MCF-7 cells,  Hela cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLEO1, also named as RNA polymerase-associated protein LEO1, is a 666 amino acid protein, which belongs to the LEO1 family. LEO1 is a component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. The calculated molecular weight of LEO1 is 75 kDa, but the modified LEO1 protein is about 105 kDa (PMID: 15632063).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag33577 Product name: Recombinant human LEO1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-332 aa of BC018147 Sequence: MADMEDLFGSDADSEAERKDSDSGSDSDSDQENAASGSNASGSESDQDERGDSGQPSNKELFGDDSEDEGASHHSGSDNHSERSDNRSEASERSDHEDNDPSDVDQHSGSEAPNDDEDEGHRSDGGSHHSEAEGSEKAHSDDEKWGREDKSDQSDDEKIQNSDDEERAQGSDEDKLQNSDDDEKMQNTDDEERPQLSDDERQQLSEEEKANSDDERPVASDNDDEKQNSDDEEQPQLSDEEKMQNSDDERPQASDEEHRHSDDEEEQDHKSESARGSDSEDEVLRMKRKNAIASDSEADSDTEVPKDNSGTMDLFGGADDISSGSDGEDKPP Predict reactive species\nFull Name: Leo1, Paf1\/RNA polymerase II complex component, homolog (S. cerevisiae)\nCalculated Molecular Weight: 666 aa, 75 kDa\nObserved Molecular Weight: 105 kDa\nGenBank Accession Number: BC018147\nGene Symbol: LEO1\nGene ID (NCBI): 123169\nRRID: AB_3085270\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8WVC0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888289960105,"sku":"68568-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68568-1-ig","provider":"Iright","version":"1.0","type":"link"}