{"product_id":"proteintech-68582-1-ig","title":"Proteintech, 68582-1-Ig, PTPIP51 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTPIP51 (68582-1-Ig) by Proteintech is a Monoclonal antibody targeting PTPIP51 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n68582-1-Ig targets PTPIP51 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HepG2 cells,  HuH-7 cells,  HT-29 cells,  HEK-293 cells,  K-562 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:238-1:952\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein tyrosine phosphatase-interacting protein 51 (PTPIP51),also known as RMDN3, is a mitochondrial membrane-anchored protein that interacts with ER membrane-bound VAPB. The VAPB-PTPIP51 interaction impacts on intracellular Ca2+ handling (PMID: 22131369, 28345618). PTPIP51 participates in multiple cellular processes, and dysfunction of PTPIP51 is implicated in diseases such as cancer and neurodegenerative disorders (PMID: 28345618).The known initiation sites in the Ptpip51 gene would lead to molecular protein masses of 52, 38 and 30 kDa (PMID: 18854601,19844996).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag15135 Product name: Recombinant human PTPIP51 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-141 aa of BC008970 Sequence: ESDNERDSDKESEDGEDEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCH Predict reactive species\nFull Name: family with sequence similarity 82, member A2\nCalculated Molecular Weight: 470 aa, 52 kDa\nObserved Molecular Weight: 52-60 kDa\nGenBank Accession Number: BC008970\nGene Symbol: PTPIP51\nGene ID (NCBI): 55177\nRRID: AB_3085282\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q96TC7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888315682985,"sku":"68582-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68582-1-ig","provider":"Iright","version":"1.0","type":"link"}