{"product_id":"proteintech-68593-1-ig","title":"Proteintech, 68593-1-Ig, NGRN Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NGRN (68593-1-Ig) by Proteintech is a Monoclonal antibody targeting NGRN in WB, ELISA applications with reactivity to Human samples\n68593-1-Ig targets NGRN in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNGRN, also named as Neugrin or FI58G, is a 291 amino acid protein, which belongs to the neugrin family. NGRN localizes in the nucleus and is expressed at high levels in heart, brain and skeletal muscle. In brain, it is mainly expressed in neurons rather than glial cells. NGRN may be  involved in neuronal differentiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6790 Product name: Recombinant human NGRN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-219 aa of BC001682 Sequence: MEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKVLKKAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLLMPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGRNKEIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREFFDSNGNFLYRI Predict reactive species\nFull Name: neugrin, neurite outgrowth associated\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 30-32 kDa\nGenBank Accession Number: BC001682\nGene Symbol: NGRN\nGene ID (NCBI): 51335\nRRID: AB_3085292\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9NPE2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888305557673,"sku":"68593-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68593-1-ig","provider":"Iright","version":"1.0","type":"link"}