{"product_id":"proteintech-68613-1-ig","title":"Proteintech, 68613-1-Ig, KANK1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe KANK1 (68613-1-Ig) by Proteintech is a Monoclonal antibody targeting KANK1 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n68613-1-Ig targets KANK1 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, PC-3 cells,  MCF-7 cells,  HeLa cells,  HEK-293 cells,  HepG2 cells,  HuH-7 cells,  Daudi cells,  Raji cells\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKANK1 (KN motif and ankyrin repeat domain-containing protein 1) is involved in the control of cytoskeleton formation by regulating actin polymerization, inhibiting actin fiber formation and cell migration (PMID: 25961457). It inhibits RhoA activity, the formation of lamellipodia but not of filopodia (PMID: 25961457, PMID: 5961457).It also inhibits fibronectin-mediated cell spreading and regulates Rac signaling pathways (PMID: 25961457). Talin-KANK1 interaction controls the recruitment of cortical microtubule stabilizing complexes to focal adhesions (PMID: 27410476). KANK1 can be detected 130-200 kDa (PMID: 15823577, PMID: 33253712, PMID: 35805114).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag31440 Product name: Recombinant human KANK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 291-467 aa of NM_015158 Sequence: ISVLQEEKRQLVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIELQQQTIESLKE Predict reactive species\nFull Name: KN motif and ankyrin repeat domains 1\nCalculated Molecular Weight: 147KD\nObserved Molecular Weight: 130-200 kDa\nGenBank Accession Number: NM_015158\nGene Symbol: KANK1\nGene ID (NCBI): 23189\nRRID: AB_3085307\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q14678\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888288190633,"sku":"68613-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68613-1-ig","provider":"Iright","version":"1.0","type":"link"}