{"product_id":"proteintech-68618-1-ig","title":"Proteintech, 68618-1-Ig, Angiopoietin 1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Angiopoietin 1 (68618-1-Ig) by Proteintech is a Monoclonal antibody targeting Angiopoietin 1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n68618-1-Ig targets Angiopoietin 1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, PNGase F treated A375 cells,  non-treated U-87 MG cells,  PNGase F treated U-87 MG cells,  non-treated HuH-7 cells,  PNGase F treated HuH-7 MG cells,  non-treated bENd.3 cells,  PNGase F treated bENd.3 cells\nPositive IF\/ICC detected in: HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAngiopoietin 1 is a 70-kDa secreted glycoprotein generated from vascular mural cells, pericytes, and certain other cells. Angiopoietin 1 participates in vascular differentiation through angiogenesis, which is the process of the growth and remodelling of existing vessels. Angiopoietin 1 is also involved in the maintenance and turnover of blood vessels in mature animals. Angiopoietin 1 binds to and activates the TEK\/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation, playing an important role in the regulation of angiogenesis. Overexpression of Angiopoietin 1 has been proven to occur in malignant glioblastoma, neuroblastoma, non-small cell lung cancer, and other tumors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18829 Product name: Recombinant human ANGPT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 161-293 aa of BC152411 Sequence: IQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAG Predict reactive species\nFull Name: angiopoietin 1\nCalculated Molecular Weight: 498 aa, 58 kDa\nObserved Molecular Weight: 70 kDa, 55 kDa\nGenBank Accession Number: BC152411\nGene Symbol: Angiopoietin 1\nGene ID (NCBI): 284\nRRID: AB_3085311\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q15389\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888018018473,"sku":"68618-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68618-1-ig","provider":"Iright","version":"1.0","type":"link"}