{"product_id":"proteintech-68640-1-ig","title":"Proteintech, 68640-1-Ig, cGAS Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe cGAS (68640-1-Ig) by Proteintech is a Monoclonal antibody targeting cGAS in WB, IF\/ICC, ELISA applications with reactivity to human samples\n68640-1-Ig targets cGAS in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Karpas-299 cells, MDA-MB-231 cells,  NCI-H1299 cells,  SCaBER cells,  A431 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\ncGAS (Cyclic GMP-AMP synthase), also known as C6orf150 or h-cGAS, is a 522 aa protein. cGAS mediates innate immune responses against invading pathogens, or against self-dsDNA, which causes autoimmune disorders. The cGAS sensor not only recognizes cytosolic dsDNA but also synthesizes the second messenger cGAMP from ATP and GTP, which then binds to and activates STING. STING undergoes conformational changes and translocation from the endoplasmic reticulum to the Golgi apparatus to encounter TBK1 and IRF3, eventually triggering the production of type I IFNs.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30074 Product name: Recombinant human C6orf150 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 322-433 aa of BC113608 Sequence: LALESKSSWPASTQEGLRIQNWLSAKVRKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKF Predict reactive species\nFull Name: chromosome 6 open reading frame 150\nCalculated Molecular Weight: 496 aa, 54 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC113608\nGene Symbol: cGAS\nGene ID (NCBI): 115004\nRRID: AB_3085328\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8N884\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888338129065,"sku":"68640-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68640-1-ig","provider":"Iright","version":"1.0","type":"link"}