{"product_id":"proteintech-68643-1-ig","title":"Proteintech, 68643-1-Ig, EGFR Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe EGFR (68643-1-Ig) by Proteintech is a Monoclonal antibody targeting EGFR in WB, IF\/ICC, FC, ELISA, Blocking applications with reactivity to human samples\n68643-1-Ig targets EGFR in WB, IF\/ICC, FC, ELISA, Blocking applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SCaBER cells, HaCaT cells,  MDA-MB-468 cells,  A431 cells\nPositive IF\/ICC detected in: HaCaT cells, A431 cells\nPositive FC detected in: A431 cells\nPositive Blocking detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\nFlow Cytometry (FC): FC : 0.20 ug per 10^6 cells in a 100 µl suspension\nBLOCKING: BLOCKING : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEGFR, also named ERBB1, is a cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. The gene resides on chromosome 7p12, encoding a 170 kDa membrane-associated glycoprotein. Recent studies have shown EGFR plays a critical role in cancer development and progression, including cell proliferation, apoptosis, angiogenesis, and metastatic spread. Mutations in this gene are associated with lung cancer. When stained with live cells, EGFR can be transported into the cell interior, which is consistent with the literature report (PMID: 18084617).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag24947 Product name: Recombinant human EGFR protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 291-534 aa of BC094761 Sequence: VCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNC Predict reactive species\nFull Name: epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)\nCalculated Molecular Weight: 134kd\nObserved Molecular Weight: 160 kDa\nGenBank Accession Number: NM_005228.5\nGene Symbol: EGFR\nGene ID (NCBI): 1956\nRRID: AB_3670387\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P00533\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888273903785,"sku":"68643-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68643-1-ig","provider":"Iright","version":"1.0","type":"link"}