{"product_id":"proteintech-68723-1-ig","title":"Proteintech, 68723-1-Ig, TREM2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TREM2 (68723-1-Ig) by Proteintech is a Monoclonal antibody targeting TREM2 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n68723-1-Ig targets TREM2 in WB, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells\nPositive IF-P detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTREM2 (triggering receptor expressed on myeloid cells 2) is a cell surface receptor belongs to TREM family that is expressed on osteoclast, dendritic cells, macrophages, nature killers, neutrophils and microglia (PMID: 19302484). TREM2 is localized predominantly in the Golgi complex, but also shuttles to and from the cell surface in endocytic and exocytic vesicles (PMID: 16675145). TREM2 associates with DAP12 to initiate the intracellular signalling cascade via an immunoreceptor tyrosine-based activation motif (ITAM) domain and tyrosine-kinases (PMID: 23977213). TREM2 has a calculated molecular mass of ~25kDa, but apparent molecular mass of ~40kDa (PMID: 24078628). In addition, TREM2 has a soluble form termed as sTREM-2 with molecular weights ranging between about 24kDa and 40kDa (PMID: 18790823). Loss-of-function mutations in either TREM2 or DAP12 can cause Nasu-Hakola disease (PMID: 19302484).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6843 Product name: Recombinant human TREM2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 22-222 aa of BC032362 Sequence: TVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRPSQGSHLPSCLSKEPLGRRNPLPTHFHPSPPGLHLSHQDSSSQRPLGCSLAWTEARDTSTQ Predict reactive species\nFull Name: triggering receptor expressed on myeloid cells 2\nCalculated Molecular Weight: 222 aa, 25 kDa\nObserved Molecular Weight: 26-32 kDa\nGenBank Accession Number: BC032362\nGene Symbol: TREM2\nGene ID (NCBI): 54209\nRRID: AB_3206275\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9NZC2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888017428649,"sku":"68723-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68723-1-ig","provider":"Iright","version":"1.0","type":"link"}