{"product_id":"proteintech-68725-1-ig","title":"Proteintech, 68725-1-Ig, ADAM17 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADAM17 (68725-1-Ig) by Proteintech is a Monoclonal antibody targeting ADAM17 in WB, ELISA applications with reactivity to Human, Mouse samples\n68725-1-Ig targets ADAM17 in WB, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, NIH\/3T3 cells,  Calu-3 cells,  A549 cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe ADAMs (A Disintegrin And Metalloprotease) are multidomain transmembrane proteins. One of the first ADAMs implicated in membrane shedding is ADAM-17, which is shown to release the active form of tumor necrosis factor (TNF)-a from its precursor (PMID:18238782). ADAM17 is also named as CSVP, TACE. The full length protein has 9 glycosylation sites, a signal peptide, propeptide and 2 isoforms produced by alternative splicing.The 120-kDa form of ADAM-17 is expressed more frequently and at higher levels in primary breast carcinomas compared with normal breast tissue(PMID:17438092).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag34022 Product name: Recombinant human ADAM17 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 693-824 aa of BC136783 Sequence: CVDKKLDKQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC Predict reactive species\nFull Name: ADAM metallopeptidase domain 17\nCalculated Molecular Weight: 824 aa, 93 kDa\nObserved Molecular Weight: 90-110 kDa\nGenBank Accession Number: BC136783\nGene Symbol: ADAM17\nGene ID (NCBI): 6868\nRRID: AB_3670417\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P78536\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888084734121,"sku":"68725-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68725-1-ig","provider":"Iright","version":"1.0","type":"link"}