{"product_id":"proteintech-68727-1-ig","title":"Proteintech, 68727-1-Ig, uPAR\/CD87 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe uPAR\/CD87 (68727-1-Ig) by Proteintech is a Monoclonal antibody targeting uPAR\/CD87 in WB, IHC, ELISA applications with reactivity to human samples\n68727-1-Ig targets uPAR\/CD87 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, U-251 cells,  A549 cells\nPositive IHC detected in: human lung squamous cell cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nuPAR is a highly glycosylated, GPI-anchored membrane protein. In addition to the membrane-anchored form, uPAR is released from the plasma membrane by cleavage of the GPI anchor and can be found as a soluble form (suPAR). uPAR contains three homologous domains (D1-D3) of which the N-terminal one (D1) represents the uPA-binding domain. After binding to uPAR, uPA cleaves plasminogen, generating the active protease plasmin which is involved in a wide variety of physiologic and pathologic processes. In addition to regulating proteolysis, uPAR has important function in cell adhesion, migration and proliferation. Studies reveal that uPAR expression is elevated during inflammation and tissue remodeling and in many human cancers, in which it frequently indicates poor prognosis. (PMID 20027185; 12461559)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28056 Product name: Recombinant human uPAR, PLAUR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 23-305 aa of BC002788 Sequence: LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG Predict reactive species\nFull Name: PLAUR\nCalculated Molecular Weight: 37 kDa\nObserved Molecular Weight: 35-50 kDa\nGenBank Accession Number: BC002788\nGene Symbol: uPAR\nGene ID (NCBI): 5329\nRRID: AB_3670419\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q03405\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888335376553,"sku":"68727-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68727-1-ig","provider":"Iright","version":"1.0","type":"link"}