{"product_id":"proteintech-68827-1-ig","title":"Proteintech, 68827-1-Ig, CD69 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD69 (68827-1-Ig) by Proteintech is a Monoclonal antibody targeting CD69 in WB, ELISA applications with reactivity to Human samples\n68827-1-Ig targets CD69 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-937 cells, THP-1 cells,  HL-60 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD69, also known as AIM, EA-1, Leu-23, and MLR3, is a type II transmembrane glycoprotein that belongs to the C-type lectin superfamily (PMID: 8340758; 7804122). CD69 is constitutively expressed by mature thymocytes, platelets, and several subsets of tissue-resident immune cells (including resident memory T cells and gamma delta T cells), and is inducibly expressed by activated T cells, B cells, natural killer (NK) cells, monocytes, neutrophils (PMID: 8100776; 28475283). CD69 has been identified as an early activation marker of lymphocytes and is commonly used as a marker of activated lymphocytes and NK cells (PMID: 28475283; 25759842). It is involved in regulating immune responses (PMID: 15745855).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG3\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30963 Product name: Recombinant human CD69 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-199 aa of BC007037 Sequence: STVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK Predict reactive species\nFull Name: CD69 molecule\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC007037\nGene Symbol: CD69\nGene ID (NCBI): 969\nRRID: AB_3670438\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q07108\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888106885289,"sku":"68827-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68827-1-ig","provider":"Iright","version":"1.0","type":"link"}