{"product_id":"proteintech-80009-1-rr","title":"Proteintech, 80009-1-RR, Collagen Type III (N-terminal) Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Collagen Type III (N-terminal) (80009-1-RR) by Proteintech is a Recombinant antibody targeting Collagen Type III (N-terminal) in IHC, IF-P, ELISA applications with reactivity to human samples\n80009-1-RR targets Collagen Type III (N-terminal) in IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human colon tissue, human colon cancer tissue,  human ovary tumor tissue,  human pancreas cancer tissue,  human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human colon tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nType III collagen is a fibrillar forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome types IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341). This antibody was raised against 24-152 aa of prepro α1 (III) chain of human type III procollagen. It can't recognize mouse or rat type III collagen.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag18658 Product name: Recombinant human COL3A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-152 aa of BC028178 Sequence: QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYS Predict reactive species\nFull Name: collagen, type III, alpha 1\nCalculated Molecular Weight: 1466 aa, 139 kDa\nGenBank Accession Number: BC028178\nGene Symbol: COL3A1\nGene ID (NCBI): 1281\nRRID: AB_2882939\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P02461\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888728264873,"sku":"80009-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-80009-1-rr","provider":"Iright","version":"1.0","type":"link"}