{"product_id":"proteintech-80272-3-rr","title":"Proteintech, 80272-3-RR, CTSA Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CTSA (80272-3-RR) by Proteintech is a Recombinant antibody targeting CTSA in WB, ELISA applications with reactivity to human samples\n80272-3-RR targets CTSA in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, DU 145 cells,  PC-3 cells,  SK-BR-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCTSA is also named as PPGB(protective protein for beta-galactosidase), PPCA(protective protein cathepsin A), cathepsin A, carboxypeptidase C, carboxypeptidase L and belongs to the peptidase S10 family. It is a ubiquitously expressed multifunctional enzyme, with deamidase, esterase, and carboxypeptidase activities and a preference for substrates with hydrophobic amino acid residues at the P1-prime position. It can be cleaved into the following 2 chains and defects in CTSA are the cause of galactosialidosis (GSL). This protein has 2 glycosylation sites. CTSA is synthesized as a 54-kDa precursor protein and composed of 32- and 20-kDa subunits linked together by disulfide bonds(PMID: 16461364,19574551).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7073 Product name: Recombinant human CTSA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 133-479 aa of BC000597 Sequence: FSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY Predict reactive species\nFull Name: cathepsin A\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 54-60, 32, 20 kDa\nGenBank Accession Number: BC000597\nGene Symbol: Cathepsin A\nGene ID (NCBI): 5476\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P10619\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888730722473,"sku":"80272-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-80272-3-rr","provider":"Iright","version":"1.0","type":"link"}