{"product_id":"proteintech-80543-1-rr","title":"Proteintech, 80543-1-RR, Connexin 43 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Connexin 43 (80543-1-RR) by Proteintech is a Recombinant antibody targeting Connexin 43 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples\n80543-1-RR targets Connexin 43 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue,  pig brain tissue,  rat cerebellum tissue\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nConnexin 43 (Cx43, also known as gap junction alpha-1), a member of connexin family, plays essential roles in gap junction communication that facilitates direct communication among adjacent cells (PMID: 12270943). Usually, six connexin proteins oligomerize into a hemi-channel or connexon during intercellular channel formation (PMID: 12270943). Mutations of Connexin 43 may cause a series of diseases such as oculodentodigital dysplasia (ODDD), syndactyly 3 (SDTY3), hypoplastic left heart syndrome 1 (HLHS1) and so on (PMID: 18161618, 1472936, 1147490).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25533 Product name: Recombinant human Connexin 43 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 232-382 aa of BC026329 Sequence: FFKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI Predict reactive species\nFull Name: gap junction protein, alpha 1, 43kDa\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC026329\nGene Symbol: Connexin-43\nGene ID (NCBI): 2697\nRRID: AB_2935545\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P17302\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888411627689,"sku":"80543-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-80543-1-rr","provider":"Iright","version":"1.0","type":"link"}