{"product_id":"proteintech-80756-1-rr","title":"Proteintech, 80756-1-RR, PAX8 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PAX8 (80756-1-RR) by Proteintech is a Recombinant antibody targeting PAX8 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n80756-1-RR targets PAX8 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SKOV-3 cells, rat kidney tissue\nPositive IHC detected in: human ovary tumor tissue, human ovary cancer tissue,  human renal cell carcinoma tissue,  human thyroid cancer tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SKOV-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:5000-1:20000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:650-1:2600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPAX8 is a member of the paired box (PAX) family of transcription factors, typically containing a paired box domain and a paired-type homeodomain. It is expressed during organogenesis of the thyroid gland, kidney and Mullerian system. It is thought to regulate the expression of Wilms tumor suppressor (WT1) gene and mutations in PAX8 have been associated with Wilms tumor cells, thyroid and ovarian carcinomas. PAX8 is a useful marker in distinguishing ovarian carcinomas from mammary carcinomas (PMID: 18724243). PAX8 is expressed in a high percentage of ovarian serous, endometrioid, and clear cell carcinomas, but only rarely in primary ovarian mucinous adenocarcinoma.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0306 Product name: Recombinant human PAX8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC001060 Sequence: MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDS Predict reactive species\nFull Name: paired box 8\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 48 kDa, 58 kDa\nGenBank Accession Number: BC001060\nGene Symbol: PAX8\nGene ID (NCBI): 7849\nRRID: AB_2923693\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q06710\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888848949417,"sku":"80756-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-80756-1-rr","provider":"Iright","version":"1.0","type":"link"}