{"product_id":"proteintech-80932-1-rr","title":"Proteintech, 80932-1-RR, DDX21 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DDX21 (80932-1-RR) by Proteintech is a Recombinant antibody targeting DDX21 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n80932-1-RR targets DDX21 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  THP-1 cells,  Jurkat cells,  K-562 cells,  HL-60 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDDX21 protein belongs to DEAD box protein family which is characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD). As a putative RNA helicase, DDX21 unwinds double-stranded RNA, folds single-stranded RNA and is involved in process including ribosomal RNA biogeneis, RNA editing and general transcription. Interaction of DDX21 and c-Jun was reported in ribosomal RNA processing. DDX21 exists as two isoforms, molecular weight of modified isoform one is about 87 -100 kDa, and the post-modified isoform is about 75-85 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0804 Product name: Recombinant human DDX21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC008071 Sequence: MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEPSEEEIDAPKPKKMKKEKEMNGETREKSPKLKNGFPHPEPDCNPSEAASEESNSEIEQEIP Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 21\nCalculated Molecular Weight: 87 kDa\nObserved Molecular Weight: 87 kDa\nGenBank Accession Number: BC008071\nGene Symbol: DDX21\nGene ID (NCBI): 9188\nRRID: AB_2918920\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NR30\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888419000489,"sku":"80932-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-80932-1-rr","provider":"Iright","version":"1.0","type":"link"}