{"product_id":"proteintech-81119-1-rr","title":"Proteintech, 81119-1-RR, Beta Actin Recombinant monoclonal antibody","description":"Size: 100ul\nThe Beta Actin (81119-1-RR) by Proteintech is a Recombinant antibody targeting Beta Actin in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n81119-1-RR targets Beta Actin in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  Jurkat cells,  NIH\/3T3 cells,  HSC-T6 cells,  mouse brain tissue,  rat brain tissue\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBeta Actin, a 42-kDa protein encoded by the ACTB gene, is a highly conserved, ubiquitous protein that forms microfilaments, making it a major component of the cell's cytoskeleton and contractile apparatus. It plays essential roles in cell structure, growth, motility, and intracellular transport, and it's also involved in gene expression regulation by associating with chromatin remodeling complexes. Due to its stable and constitutive expression across different tissues and under most experimental conditions, beta-actin is extensively utilized as an internal loading control in molecular biology techniques, including Western blotting, quantitative PCR (qPCR), and immunohistochemistry, for normalizing gene and protein expression data. Based on epitope identification, this antibody specifically recognizes ACTB and does not exhibit cross-reactivity with ACTA1\/ACTA2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14521 Product name: Recombinant human beta actin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC002409 Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK Predict reactive species\nFull Name: actin, beta\nCalculated Molecular Weight: 375 aa, 42 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC002409\nGene Symbol: Beta Actin\nGene ID (NCBI): 60\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P60709\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888711291049,"sku":"81119-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-81119-1-rr","provider":"Iright","version":"1.0","type":"link"}