{"product_id":"proteintech-81161-3-rr","title":"Proteintech, 81161-3-RR, ZAK Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ZAK (81161-3-RR) by Proteintech is a Recombinant antibody targeting ZAK in IHC, IF\/ICC, ELISA applications with reactivity to human samples\n81161-3-RR targets ZAK in IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZAK(sterile-alpha motif and leucine zipper containing kinase AZK) is also named as MLTK, MAPKKK, mlklak, MLK7, AZK, MLT, MRK, HCCS-4, MAP3K20 and belongs to the MAPKKK family. It is a mitogen-activated protein kinase kinase kinase (MAP3K) that activates the stress-activated protein kinase\/c-jun N-terminal kinase pathway and activates NF-kappaB. ZAK contributes to regulation of DNA damage checkpoints through a p38 gamma-independent pathway. This protein has 3 isoforms produced by alternative splicing with the MW of 91 kDa (ZAK alpha), 51 kDa (ZAK beta) and 35 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag30599 Product name: Recombinant human ZAK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 223-325 aa of BC001401 Sequence: ERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQ Predict reactive species\nFull Name: sterile alpha motif and leucine zipper containing kinase AZK\nCalculated Molecular Weight: 91 kDa\nGenBank Accession Number: BC001401\nGene Symbol: ZAK\nGene ID (NCBI): 51776\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NYL2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888843313321,"sku":"81161-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-81161-3-rr","provider":"Iright","version":"1.0","type":"link"}