{"product_id":"proteintech-81202-2-rr","title":"Proteintech, 81202-2-RR, mCherry Recombinant monoclonal antibody","description":"Size: 100ul\nThe mCherry (81202-2-RR) by Proteintech is a Recombinant antibody targeting mCherry in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to recombinant protein samples\n81202-2-RR targets mCherry in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with recombinant protein samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Transfected HEK-293T cells\nPositive IF\/ICC detected in: Transfected HEK-293 cells\nPositive FC (Intra) detected in: Transfected HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRed fluorescent proteins (RFPs) is a collective term referring to a heterogeneous group of red chromophore-carrying proteins, originating from various species and forming different protein lineages.\nThe original RFP (dsRed) is a 225 amino acid fluorescent protein (25.9 kDa) derived from Discosoma sp.. It emits red light with a peak wavelength of 593 nm upon excitation by green light (excitation peak at 558 nm). \nWhen fused with other proteins, RFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitating visualization of subcellular localization through fluorescence microscopy.\nThis antibody is a rabbit polyclonal antibody raised against mCherry.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: recombinant protein\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25320 Product name: Recombinant mCherry protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-235 aa of Sequence: VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK Predict reactive species\nFull Name: mCherry\nCalculated Molecular Weight: 27 kDa\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888649130153,"sku":"81202-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-81202-2-rr","provider":"Iright","version":"1.0","type":"link"}