{"product_id":"proteintech-81225-1-rr","title":"Proteintech, 81225-1-RR, GRB10 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GRB10 (81225-1-RR) by Proteintech is a Recombinant antibody targeting GRB10 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n81225-1-RR targets GRB10 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, NIH\/3T3 cells,  HSC-T6 cells\nPositive IF\/ICC detected in: LNCaP cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGRB10 is an adapter protein which modulates coupling of a number of cell surface receptor kinases with specific signaling pathways. GRB10 has three consensus domains including pleckstrin homology (PH) domain, SH2\/SH3 domain and Ras-associating domain. By binding to kinases, GRB10 suppresses signals from activated receptors tyrosine kinases, including INSR and IGF1R. It may play a role in mediating ubiquitination of INSR, leading to proteasomal degradation. GRB10 has 4 isoforms with the molecular mass of 60-70 kDa, which are produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag20355 Product name: Recombinant human GRB10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC024285 Sequence: MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQQFRTSSLPAI Predict reactive species\nFull Name: growth factor receptor-bound protein 10\nCalculated Molecular Weight: 536aa,61 kDa; 594aa,67 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC024285\nGene Symbol: GRB10\nGene ID (NCBI): 2887\nRRID: AB_2923710\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13322\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888428404905,"sku":"81225-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-81225-1-rr","provider":"Iright","version":"1.0","type":"link"}