{"product_id":"proteintech-81570-1-rr","title":"Proteintech, 81570-1-RR, MYL7 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MYL7 (81570-1-RR) by Proteintech is a Recombinant antibody targeting MYL7 in WB, IHC, ELISA applications with reactivity to mouse, rat, human samples\n81570-1-RR targets MYL7 in WB, IHC, ELISA applications and shows reactivity with mouse, rat, human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, rat heart tissue\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYL7, also known as myosin light chain 2a (MLC2a),  is essential for heart development. The expression of MYL7 in heart is predominatantly restricted to the atrium. So its expression has been considered as useful marker for atrial cardiomyocytes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat, human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag11058 Product name: Recombinant human MYL7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-175 aa of BC027915 Sequence: MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE Predict reactive species\nFull Name: myosin, light chain 7, regulatory\nCalculated Molecular Weight: 175 aa, 19 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC027915\nGene Symbol: MYL7\nGene ID (NCBI): 58498\nRRID: AB_2935563\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q01449\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888436301993,"sku":"81570-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-81570-1-rr","provider":"Iright","version":"1.0","type":"link"}