{"product_id":"proteintech-82673-2-rr","title":"Proteintech, 82673-2-RR, MFN2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MFN2 (82673-2-RR) by Proteintech is a Recombinant antibody targeting MFN2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, rat samples\n82673-2-RR targets MFN2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, K-562 cells,  NIH\/3T3 cells,  HSC-T6 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitofusin-2 (MFN2), a mitochondrial membrane protein, is a dynamin-like GTPase embedded in the outer mitochondrial membrane (OMM) which plays a central role in regulating mitochondrial fusion and cell metabolism (PMID: 35399520; 34026850). There are two human mitofusin isoforms MFN1 and MFN2, MFN1 and MFN2 mediate outer membrane fusion, OPA1 is involved in inner membrane fusion, and DRP1 is responsible for mitochondrial fission (PMID: 17084350; 35399520). It has been shown that MFN2 participates in multiple cellular biological processes under physical and pathological conditions. Apart from mitochondria fusion, MFN2 is also involved in mitochondrial-ER contacts (MERCs), mitophagy, cellular apoptosis, and proliferation (PMID: 34026850).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2845 Product name: Recombinant human MFN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-353 aa of BC017061 Sequence: SLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSA Predict reactive species\nFull Name: mitofusin 2\nCalculated Molecular Weight: 757 aa, 86 kDa\nObserved Molecular Weight: 86 kDa\nGenBank Accession Number: BC017061\nGene Symbol: MFN2\nGene ID (NCBI): 9927\nENSEMBL Gene ID: ENSG00000116688\nRRID: AB_3086501\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O95140\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888435155113,"sku":"82673-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-82673-2-rr","provider":"Iright","version":"1.0","type":"link"}