{"product_id":"proteintech-82700-8-rr","title":"Proteintech, 82700-8-RR, Cyclin E1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Cyclin E1 (82700-8-RR) by Proteintech is a Recombinant antibody targeting Cyclin E1 in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n82700-8-RR targets Cyclin E1 in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: MCF-7 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:150-1:600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclin E1 (CCNE1) is a member of the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. CCNE1, an essential cyclin activating Cdk2, regulates the G1-S phase transition of the mammalian cell division cycle. Its timing expression plays a direct role in the initiation of DNA replication , the control of histone biosynthesis, and the centrosome cycle. CCNE1 is associated with disease progression in various malignancies and is associated clinically with poor prognosis. Two bands of Cyclin E1 were expressed in U2OS and MDA-MB-231 cells (PMID:9858585, PMID: 24112607).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2110 Product name: Recombinant human Cyclin E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 111-410 aa of BC035498 Sequence: ANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA Predict reactive species\nFull Name: cyclin E1\nCalculated Molecular Weight: 410 aa, 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC035498\nGene Symbol: Cyclin E1\nGene ID (NCBI): 898\nRRID: AB_3670532\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P24864\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888857043113,"sku":"82700-8-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-82700-8-rr","provider":"Iright","version":"1.0","type":"link"}