{"product_id":"proteintech-82747-6-rr","title":"Proteintech, 82747-6-RR, CD79a Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD79a (82747-6-RR) by Proteintech is a Recombinant antibody targeting CD79a in WB, ELISA applications with reactivity to human samples\n82747-6-RR targets CD79a in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, Raji cells,  Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD79a, also named as B-cell antigen receptor complex-associated protein alpha chain or MB-1 membrane glycoprotein, is a 226 amino acid protein, which contains one ITAM domain and one Ig-like C2-type (immunoglobulin-like) domain. CD79A is expressed in B cells and localizes in the cell membrane. CD79A is required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. CD79A is also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag17924 Product name: Recombinant human CD79A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-144 aa of BC113733 Sequence: LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRI Predict reactive species\nFull Name: CD79a molecule, immunoglobulin-associated alpha\nCalculated Molecular Weight: 226 aa, 25 kDa\nObserved Molecular Weight: 38-45 kDa\nGenBank Accession Number: BC113733\nGene Symbol: CD79A\nGene ID (NCBI): 973\nRRID: AB_3670545\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P11912\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888603418793,"sku":"82747-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-82747-6-rr","provider":"Iright","version":"1.0","type":"link"}