{"product_id":"proteintech-82780-6-rr","title":"Proteintech, 82780-6-RR, Beta Arrestin 2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Beta Arrestin 2 (82780-6-RR) by Proteintech is a Recombinant antibody targeting Beta Arrestin 2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n82780-6-RR targets Beta Arrestin 2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBeta Arrestin 2 is a member of arrestin\/beta-arrestin protein family, which are expressed at high levels in the central nervous system (CNS) and play a critical role in the regulation of G-protein coupled receptors (GPCRs) including MOR. Beta Arrestin 2 is an adaptor protein that is important for the regulation of receptors belonging to both dopaminergic and opioid systems. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0227 Product name: Recombinant human Beta Arrestin 2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 163-409 aa of BC007427 Sequence: NSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC Predict reactive species\nFull Name: arrestin, beta 2\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 47-50 kDa\nGenBank Accession Number: BC007427\nGene Symbol: Beta Arrestin 2\nGene ID (NCBI): 409\nRRID: AB_3670548\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P32121\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888591229097,"sku":"82780-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-82780-6-rr","provider":"Iright","version":"1.0","type":"link"}