{"product_id":"proteintech-82829-1-rr","title":"Proteintech, 82829-1-RR, CLOCK Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CLOCK (82829-1-RR) by Proteintech is a Recombinant antibody targeting CLOCK in WB, IHC, ELISA, ChIP-qPCR applications with reactivity to human, mouse, rat samples\n82829-1-RR targets CLOCK in WB, IHC, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse testis tissue,  HEK-293 cells,  A431 cells,  PC-3 cells,  NIH\/3T3 cells,  rat testis tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive ChIP-qPCR detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nCHIP-QPCR: CHIP-QPCR : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCircadian locomoter output cycles protein kaput (CLOCK), also named as BHLHE8 or KIAA0334, is a 846 amino acid protein, which contains one bHLH domain, one PAC domain, and two PAS domains. CLOCK localizes in the nucleus and cytoplasm. CLOCK) is expressed in all tissues examined including spleen, thymus, prostate, testis, ovary, small intestine, colon, leukocytes, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. ARNTL\/2-CLOCK heterodimers activate E-box element (5'-CACGTG-3') transcription of a number of proteins of the circadian clock, such as PER1 and PER2. The calculated molecular weight of CLOCK is 95kDa, we detected a 95-110 kDa protein by western blot. Our result is similar to the result of reseach paper (PMID: 30683868).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag30011 Product name: Recombinant human CLOCK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC041878 Sequence: MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFISNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWL Predict reactive species\nFull Name: clock homolog (mouse)\nCalculated Molecular Weight: 846 aa, 95 kDa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: BC041878\nGene Symbol: CLOCK\nGene ID (NCBI): 9575\nRRID: AB_3086549\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O15516\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888348680361,"sku":"82829-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-82829-1-rr","provider":"Iright","version":"1.0","type":"link"}