{"product_id":"proteintech-82848-4-rr","title":"Proteintech, 82848-4-RR, CHRNA7 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CHRNA7 (82848-4-RR) by Proteintech is a Recombinant antibody targeting CHRNA7 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n82848-4-RR targets CHRNA7 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, mouse brain tissue\nPositive FC (Intra) detected in: SH-SY5Y cells, Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNicotinic acetylcholine receptors (nAChRs) are cholinergic receptors that form ligand-gated ion channels that mediate fast signal transmission at synapses. CHRNA7 (neuronal acetylcholine receptor subunit alpha-7) forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. CHRNA7, so that like CHRNA7, the epithelial CHRFAM7A ORF encodes a protein (48 kDa) that differs from the CHRNA7 (58 kDa) by a distinct amino terminus and molecular weight.(PMID: 25473097)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag15980 Product name: Recombinant human CHRNA7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 130-321 aa of BC037571 Sequence: TVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA Predict reactive species\nFull Name: cholinergic receptor, nicotinic, alpha 7\nCalculated Molecular Weight: 502 aa, 56 kDa\nObserved Molecular Weight: 50 kDa, 56 kDa\nGenBank Accession Number: BC037571\nGene Symbol: CHRNA7\nGene ID (NCBI): 1139\nRRID: AB_3670575\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P36544\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888404484265,"sku":"82848-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-82848-4-rr","provider":"Iright","version":"1.0","type":"link"}