{"product_id":"proteintech-82853-2-rr","title":"Proteintech, 82853-2-RR, TMEM27 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TMEM27 (82853-2-RR) by Proteintech is a Recombinant antibody targeting TMEM27 in WB, ELISA applications with reactivity to human samples\n82853-2-RR targets TMEM27 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM27 (also termed collectrin), a 46 kDa type I transmembrane protein, is a homolog of the noncatalytic domain of angiotensin-converting enzyme-related carboxypeptidase (Ace2). Its expression has only been reported in the brush border membrane of the proximal tubules and collecting ducts of the kidney and in the pancreatic b cell (PMID: 11278314, 16330324). Overexpression of TMEM27 in b cells leads to increased proliferation in vitro and increased pancreatic b cell mass in vivo, and also has been reported to augment glucosestimulated ins secretion (GSIS) (PMID: 16330324, 16330323). The abundance of TMEM27 protein in b cells is furthermore regulated by ectodomain cleavage, which leads to two cleavage products, a 25 kDa N-terminal part that is released into the extracellular space (the shed fragment), and a 22 kDa C-terminal fragment (CTF) remaining in the membrane that is rapidly degraded (PMID: 16330324). TMEM27 is an N-glycosylated protein and can form dimers with MW of 64-75 kDa(patent US 20100119489 A1). TMEM27 can be used as a beta cell mass biomarker (PMID: 20386877, 21907142).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7668 Product name: Recombinant human TMEM27 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-143 aa of BC050606 Sequence: VRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLNDQTLEFLKIPSTLAPPMDPSVPIW Predict reactive species\nFull Name: transmembrane protein 27\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC050606\nGene Symbol: TMEM27\nGene ID (NCBI): 57393\nRRID: AB_3670578\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9HBJ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888670068905,"sku":"82853-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-82853-2-rr","provider":"Iright","version":"1.0","type":"link"}