{"product_id":"proteintech-82903-1-rr","title":"Proteintech, 82903-1-RR, KIF15 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe KIF15 (82903-1-RR) by Proteintech is a Recombinant antibody targeting KIF15 in WB, IHC, ELISA applications with reactivity to human samples\n82903-1-RR targets KIF15 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells,  K-562 cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKIF15, also named as KLP2 and KNSL7, belongs to the kinesin-like protein family and KLP2 subfamily. It is a plus-end directed kinesin-like motor enzyme which involved in mitotic spindle assembly. Several isoforms of KIF15 exist due to the alternative splicing, with molecular weight between 130-160 kDa. Sometimes higher molecular weight around 200 kDa can also be observed, which may be a modified variant of KIF15. (14618103)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag33897 Product name: Recombinant human KIF15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 950-1050 aa of NM_020242 Sequence: EQQMAKVQKLEESLLATEKVISSLEKSRDSDKKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILDLKETLRLR Predict reactive species\nFull Name: kinesin family member 15\nCalculated Molecular Weight: 160 kDa\nObserved Molecular Weight: 160 kDa\nGenBank Accession Number: NM_020242\nGene Symbol: KIF15\nGene ID (NCBI): 56992\nRRID: AB_3670632\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NS87\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888646705321,"sku":"82903-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-82903-1-rr","provider":"Iright","version":"1.0","type":"link"}