{"product_id":"proteintech-82909-8-rr","title":"Proteintech, 82909-8-RR, CD147 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD147 (82909-8-RR) by Proteintech is a Recombinant antibody targeting CD147 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n82909-8-RR targets CD147 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  RAW 264.7 cells,  mouse spleen tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD147, also known as Basigin or extracellular matrix metalloproteinase inducer (EMMPRIN), is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily (PMID: 7812975). The molecule is composed of an intracellular portion, an extracellular portion and a single transmembrane region. CD147 is expressed on a variety of cell types (e.g., hematopoietic, epithelial, and endothelial cells) and at varying levels (PMID: 32968061). Increased expression of CD147 occurs in many tumors. CD147 is a pleiotropic molecule that plays an important role in fetal, neuronal, lymphocyte and extracellular matrix development (PMID: 17945211). CD147 has been identified as a receptor essential for erythrocyte invasion by Plasmodium falciparum (PMID: 22080952). It has been reported that spike protein of SARS-CoV-2 binds to CD147 on host cells, thereby mediating the viral invasion (Wang, Ke, et al, BioRxiv, 2020).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0436 Product name: Recombinant Human CD147 protein (His Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 138-323 aa of BC009040 Sequence: EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA Predict reactive species\nFull Name: basigin (Ok blood group)\nCalculated Molecular Weight: 385 aa, 42 kDa\nObserved Molecular Weight: 35-60 kDa\nGenBank Accession Number: BC009040\nGene Symbol: CD147\nGene ID (NCBI): 682\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P35613\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888718565545,"sku":"82909-8-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-82909-8-rr","provider":"Iright","version":"1.0","type":"link"}