{"product_id":"proteintech-82949-1-rr","title":"Proteintech, 82949-1-RR, GPX4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GPX4 (82949-1-RR) by Proteintech is a Recombinant antibody targeting GPX4 in IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n82949-1-RR targets GPX4 in IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:150-1:600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701). It presents primarily in testis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5809 Product name: Recombinant human GPX4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC022071 Sequence: MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ Predict reactive species\nFull Name: glutathione peroxidase 4 (phospholipid hydroperoxidase)\nCalculated Molecular Weight: 22 kDa\nGenBank Accession Number: BC022071\nGene Symbol: GPX4\nGene ID (NCBI): 2879\nRRID: AB_3670692\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P36969\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888850227369,"sku":"82949-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-82949-1-rr","provider":"Iright","version":"1.0","type":"link"}