{"product_id":"proteintech-83026-6-rr","title":"Proteintech, 83026-6-RR, ACVR1B Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ACVR1B (83026-6-RR) by Proteintech is a Recombinant antibody targeting ACVR1B in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n83026-6-RR targets ACVR1B in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, HepG2 cells,  HEK-293 cells\nPositive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: A549 cells, HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACVR1B (ALK4,  activin A receptor type 1B) is a transforming growth factor-beta (TGF-beta) superfamily member (PMID: 37020544). A potential role for ACVR1B in regulating muscle mass is that it is part of the transforming growth factor b (TGFb) pathway regulating myostatin (PMID: 21063444).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0129 Product name: Recombinant human ACVR1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 211-448 aa of BC000254 Sequence: EIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVC Predict reactive species\nFull Name: activin A receptor, type IB\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC000254\nGene Symbol: ACVR1B\nGene ID (NCBI): 91\nRRID: AB_3670766\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P36896\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888383348905,"sku":"83026-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83026-6-rr","provider":"Iright","version":"1.0","type":"link"}